dettagli azienda
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Attività di tipo:fabbricante
  • Main Mark: Americas , Asia , Europa dell'est , Europa , Nord Europa , Altri mercati , Europa occidentale , In tutto il mondo
  • esportatore:91% - 100%
  • Karts:GS, CE, ISO9001, ISO14000
  • descrizione:Fragmento dell'ormone paratiroideo 52232-67-4,Fragmento dell'ormone paratiroideo CAS 52232-67-4,PTH 1-34 Umano
Taizhou Volsen Chemical Co., Ltd. Fragmento dell'ormone paratiroideo 52232-67-4,Fragmento dell'ormone paratiroideo CAS 52232-67-4,PTH 1-34 Umano
Casa > Elenco prodotti > Prodotti peptidici > Fragmento dell'ormone paratiroideo (1-34) (CAS 52232-67-4)

Fragmento dell'ormone paratiroideo (1-34) (CAS 52232-67-4)

Condividi:  
    Prezzo unitario: USD 1 / Kilogram
    Tipo di pagamento: T/T
    Incoterm: CIF
    Quantità di ordine minimo: 1 Kilogram
    Termine di consegna: 15 giorni

Informazioni basilari

Modello: 52232-67-4

Additional Info

Pacchetto: COME RICHIESTO

produttività: KGS

marchio: VOLSENCHEM

Trasporti: Air

Luogo di origine: CINA

Abilità del rifornimento: TRUE MANUFACTURER

Certificati : GMP Peptide

Descrizione del prodotto


Siamo uno dei Teriparatide acetato

CAS 52232-67-4 fornitori nel mercato cinese. Teriparatide è una forma ricombinante dell'ormone paratiroideo. È un efficace agente anabolizzante (ossia, la crescita delle ossa) utilizzato nel trattamento di alcune forme di osteoporosi e anche occasionalmente usato fuori-etichetta per accelerare la guarigione di frattura. L'acetato di Teriparatide 52232-67-4 è conosciuto per un'azione veloce, una qualità costante e un'elevata purezza. Siamo molto apprezzati da molti clienti che abbiamo collaborato.



Thera. Cat goria: Pharmaceutical Peptide

CAS n. 52232-67-4

Sinonimi: ormone paratiroideo UMANE: Frammento 1-34; Ormone paratiroideo (HUMAN, 1-34); L'ormone paratiroideo (1-34), UMANA; PTH (1-34) (umana); PTH (HUMAN, 1-34); teriparatide; Teriparatide acetato; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formula molecolare: C172H278N52O47S2

Peso Molecolare: 3.890,49,792 mila

Purezza: ≥98%

Imballaggio: Imballaggio degno

Scheda di sicurezza disponibile su richiesta

Uso: nel trattamento di alcune forme di osteoporosi

Elenco prodotti : Prodotti peptidici

Immagine prodotto
  • Fragmento dell'ormone paratiroideo (1-34) (CAS 52232-67-4)
Mail a questo fornitore
  • *Oggetto:
  • *messaggi:
    Il tuo messaggio deve essere compreso tra 20-8000 caratteri

Sito Web mobile indice. Mappa del sito


Iscriviti alla nostra newsletter:
Ottieni aggiornamenti, Offerte Speciali, grandi Premi, sconti

MultiLanguage:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Tutti i diritti riservati
Comunicare con Fornitore?Fornitore
Amy Cheng Ms. Amy Cheng
Cosa posso fare per te?
Chatta adesso Contattare il Fornitore