Comunicare con Fornitore? Fornitore
Amy Cheng Ms. Amy Cheng
Cosa posso fare per te?
Chatta adesso Contattare il Fornitore
Taizhou Volsen Chemical Co., Ltd.
HomeElenco prodottiProdotti peptidiciPARATIROIDO ORMONO (UMANO, 1-34) 52232-67-4
PARATIROIDO ORMONO (UMANO, 1-34) 52232-67-4
  • PARATIROIDO ORMONO (UMANO, 1-34) 52232-67-4

PARATIROIDO ORMONO (UMANO, 1-34) 52232-67-4

    Prezzo unitario: USD 1 / Kilogram
    Tipo di pagamento: T/T
    Incoterm: CIF
    Quantità di ordine minimo: 1 Kilogram
    Termine di consegna: 15 giorni

Informazioni basilari

Modello: 52232-67-4

Additional Info

Pacchetto: COME RICHIESTO

produttività: KGS

marchio: VOLSENCHEM

Trasporti: Air

Luogo di origine: CINA

Abilità del rifornimento: TRUE MANUFACTURER

Certificati : GMP Peptide

Descrizione del prodotto

> We, Cina Teriparatide Acetate 52232-67-4 Font-size: 13px; linea-altezza: 19.5px; colore: # 000000; sfondo-colore: #FFFFFF; "> Fornitori e Font-family: Arial; background-color: #FFFFFF; "> Produttori, forniscono Cina Colore: #FFFFFF; "> prodotto E i prodotti correlati con Cina PARATIOIDO HORMONE UMANO 1-34 Thera. Gatto Peptide Farmaceutico .: 52232-67-4 Cas No Sinonimi

>; PARATIOIDO HORMONE (1-34), UMANO ; PTH (HUMAN, 1-34) ; ">; TERIPARATIDE ; Acetato ; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF >

; Text-indent: -21pt; "> buona qualità Polipeptide Ormoni Powder Teriparatide


Formula molecolare C172H278N52O47S2 < -family: Arial; "> / P>

Peso molecolare 3890.49792 Span style = "line-height: 1.5;"> Purezza:

Imballaggio : Esportazione imballaggio degno : Scheda di sicurezza dei materiali = "Font-family: Arial;"> Disponibile su richiesta Teriparatide è identico a una porzione di ormone paratyrod umano (PTH) e l'uso intermittente attiva gli osteoblasti più degli osteoclati L'aumento complessivo dell'osso.

Prodotti peptidici

Mail a questo fornitore
  • Amy ChengMs. Amy Cheng
  • Il tuo messaggio deve essere compreso tra 20-8000 caratteri