dettagli azienda
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Attività di tipo:fabbricante
  • Main Mark: Americas , Asia , Europa dell'est , Europa , Nord Europa , Altri mercati , Europa occidentale , In tutto il mondo
  • esportatore:91% - 100%
  • Karts:GS, CE, ISO9001, ISO14000
  • descrizione:teriparatide Acetato,52232-67-4,CAS 52232-67-4
Taizhou Volsen Chemical Co., Ltd. teriparatide Acetato,52232-67-4,CAS 52232-67-4
Casa > Elenco prodotti > Prodotti peptidici > Teriparatide Acetato 52232-67-4

Teriparatide Acetato 52232-67-4

Condividi:  
    Prezzo unitario: 1~1 USD
    Tipo di pagamento: T/T
    Incoterm: CIF
    Quantità di ordine minimo: 1 Kilogram
    Termine di consegna: 15 giorni

Informazioni basilari

Modello: 52232-67-4

Additional Info

Pacchetto: COME RICHIESTO

produttività: KGS

marchio: VOLSENCHEM

Trasporti: Air

Luogo di origine: CINA

Abilità del rifornimento: TRUE MANUFACTURER

Certificati : GMP Peptide

Descrizione del prodotto

Noi, la Cina Teriparatide acetato 52232-67-4 Fornitori e Cina PTH (1-34) (umana) | teriparatide Produttori, forniscono la Cina paratiroideo frammento ormone (1-34) dei prodotti e dei prodotti connessi con la Cina ormone paratiroideo 1-34 UMANA

Thera. Cat goria: Pharmaceutical Peptide

CAS n. 52232-67-4

Sinonimi: ormone paratiroideo UMANE: Frammento 1-34; Ormone paratiroideo (HUMAN, 1-34); L'ormone paratiroideo (1-34), UMANA; PTH (1-34) (umana); PTH (HUMAN, 1-34); teriparatide; Teriparatide acetato; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formula molecolare: C172H278N52O47S2

Peso Molecolare: 3.890,49,792 mila

Purezza: ≥98%

Imballaggio: Imballaggio degno

Scheda di sicurezza disponibile su richiesta

Utilizzo: Teriparatide è identica ad una porzione di ormone umano parathyrod (PTH) e uso intermittente attiva osteoblasti più osteoclates, che porta ad un aumento globale osso.

Elenco prodotti : Prodotti peptidici

Immagine prodotto
  • Teriparatide Acetato 52232-67-4
Mail a questo fornitore
  • *Oggetto:
  • *messaggi:
    Il tuo messaggio deve essere compreso tra 20-8000 caratteri

Sito Web mobile indice. Mappa del sito


Iscriviti alla nostra newsletter:
Ottieni aggiornamenti, Offerte Speciali, grandi Premi, sconti

MultiLanguage:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Tutti i diritti riservati
Comunicare con Fornitore?Fornitore
Amy Cheng Ms. Amy Cheng
Cosa posso fare per te?
Chatta adesso Contattare il Fornitore